ARL8A Antibody

Name ARL8A Antibody
Supplier Novus Biologicals
Catalog NBP1-58860
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Bovine, Guinea Pig, Rabbit, Sheep
Antigen Synthetic peptides corresponding to ARL8A(ADP-ribosylation factor-like 8A) The peptide sequence was selected from the middle region of ARL8A. Peptide sequence IGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQ.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene ARL8A
Supplier Page Shop

Product images