Name | ARL8A Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58860 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Bovine, Guinea Pig, Rabbit, Sheep |
Antigen | Synthetic peptides corresponding to ARL8A(ADP-ribosylation factor-like 8A) The peptide sequence was selected from the middle region of ARL8A. Peptide sequence IGGQPRFRSMWERYCRGVSAIVYMVDAADQEKIEASKNELHNLLDKPQLQ. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | ARL8A |
Supplier Page | Shop |