MYD118 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-58997
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Applications: WB IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to GADD45B(growth arrest and DNA-damage-inducible, beta) The peptide sequence was selected from the middle region of GADD45B. Peptide sequence FCCDNDINIVRVSGMQRLAQLLGEPAETQGTTEARDLHCLLVTNPHTDAW.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: GADD45B
• Conjugate: Unconjugated

Product images

Western Blot: MYD118 Antibody [NBP1-58997] - Fetal Lung lysates, Antibody Dilution: 3.0 ug/ml.

Immunohistochemistry: MYD118 Antibody [NBP1-58997] - Product Page for GADD45B antibody - middle region Sample Type : Human Prostate Cancer Primary Antibody Dilution : 2 ug/mL Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue) Gene Name: GADD45B

Western Blot: MYD118 Antibody [NBP1-58997] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry: MYD118 Antibody [NBP1-58997] - Product Page for GADD45B antibody - middle region Sample Type : Human Prostate Cancer Primary Antibody Dilution : 2 ug/mL Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue) Gene Name: GADD45B

Immunohistochemistry: MYD118 Antibody [NBP1-58997] - Product Page for GADD45B antibody - middle region Sample Type : Human Prostate Cancer Primary Antibody Dilution : 2 ug/mL Color/Signal Descriptions: GADD45B (DAB; brown), nuclei (hematoxylin; blue) Gene Name: GADD45B