ASB5 Antibody

Name ASB5 Antibody
Supplier Novus Biologicals
Catalog NBP1-59065
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ASB5(ankyrin repeat and SOCS box-containing 5) The peptide sequence was selected from the C terminal of ASB5. Peptide sequence LLLEFGADINAKNTELLRPIDVATSSSMVERILLQHEATPSSLYQLCRLC.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ASB5
Conjugate Unconjugated
Supplier Page Shop

Product images