C1QB Antibody
| Name | C1QB Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59056 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C1QB(complement component 1, q subcomponent, B chain) The peptide sequence was selected from the C terminal of C1QB. Peptide sequence AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | C1QB |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: C1QB Antibody [NBP1-59056] - Jurkat cell lysate, concentration 0.5ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14494_C1QB-Antibody-Western-Blot-NBP1-59056-img0001.jpg)
![Immunohistochemistry-Paraffin: C1QB Antibody [NBP1-59056] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/14495_C1QB-Antibody-Immunohistochemistry-Paraffin-NBP1-59056-img0003.jpg)