TSPAN6 Antibody
| Name | TSPAN6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59047 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human, Mouse, Rat, Pig, Dog, Guinea Pig |
| Antigen | Synthetic peptides corresponding to TSPAN6(tetraspanin 6) The peptide sequence was selected from the N terminal of TSPAN6. Peptide sequence VGIWGKVSLENYFSLLNEKATNVPFVLIATGTVIILLGTFGCFATCRASA. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TSPAN6 |
| Supplier Page | Shop |
Product images
![Western Blot: Tetraspanin-6 Antibody [NBP1-59047] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_3/7490_Tetraspanin-6%2520Antibody-Western%2520Blot-NBP1-59047-img0003.jpg)
Western Blot: Tetraspanin-6 Antibody [NBP1-59047] - Titration: 0.2-1 ug/ml, Positive Control: Human Muscle.