Adenylate Cyclase 6 Antibody
| Name | Adenylate Cyclase 6 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59023 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ADCY6(adenylate cyclase 6) The peptide sequence was selected from the C terminal of ADCY6 (NP_066193). Peptide sequence LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ADCY6 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023] - Sample Tissue: Human Fetal Kidney Antibody Dilution: 1.0 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24477_Adenylate-Cyclase-6-Antibody-Western-Blot-NBP1-59023-img0003.jpg)
![Western Blot: Adenylate Cyclase 6 Antibody [NBP1-59023] - Hela cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24478_Adenylate-Cyclase-6-Antibody-Western-Blot-NBP1-59023-img0002.jpg)