| Name | Atlastin-2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59016 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ARL6IP2(ADP-ribosylation factor-like 6 interacting protein 2) The peptide sequence was selected from the C terminal of ARL6IP2. Peptide sequence MEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ATL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |