Claudin-9 Antibody
| Name | Claudin-9 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59156 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CLDN9 (claudin 9) The peptide sequence was selected from the C terminal of CLDN9. Peptide sequence WAAAALLMLGGGLLCCTCPPPQVERPRGPRLGYSIPSRSGASGLDKRDYV. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CLDN9 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: Claudin-9 Antibody [NBP1-59156] - HepG2 cell lysate, concentration 2.0ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/7233_Claudin-9-Antibody-Western-Blot-NBP1-59156-img0003.jpg)
Western Blot: Claudin-9 Antibody [NBP1-59156] - HepG2 cell lysate, concentration 2.0ug/ml.