Name | MYBPH Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59131 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to MYBPH(myosin binding protein H) The peptide sequence was selected from the N terminal of MYBPH (NP_004988). Peptide sequence LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP. |
Purity/Format | Affinity purified |
Description | Rabbit Polyclonal |
Gene | MYBPH |
Supplier Page | Shop |