MYBPH Antibody

Name MYBPH Antibody
Supplier Novus Biologicals
Catalog NBP1-59131
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to MYBPH(myosin binding protein H) The peptide sequence was selected from the N terminal of MYBPH (NP_004988). Peptide sequence LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP.
Purity/Format Affinity purified
Description Rabbit Polyclonal
Gene MYBPH
Supplier Page Shop

Product images