PDCD7 Antibody

Name PDCD7 Antibody
Supplier Novus Biologicals
Catalog NBP1-59082
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PDCD7(programmed cell death 7) The peptide sequence was selected from the middle region of PDCD7. Peptide sequence YLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWAT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PDCD7
Conjugate Unconjugated
Supplier Page Shop

Product images