NELL2 Antibody
| Name | NELL2 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59273 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NELL2(NEL-like 2 (chicken)) The peptide sequence was selected from the N terminal of NELL2. Peptide sequence MESRVLLRTFCLIFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPG. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | NELL2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NELL2 Antibody [NBP1-59273] - Titration: 5.0ug/ml Positive Control: Transfected 293T.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17237_NELL2%2520Antibody-Western%2520Blot-NBP1-59273-img0003.jpg)
Western Blot: NELL2 Antibody [NBP1-59273] - Titration: 5.0ug/ml Positive Control: Transfected 293T.