Cadherin-23 Antibody

Name Cadherin-23 Antibody
Supplier Novus Biologicals
Catalog NBP1-59271
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CDH23(cadherin-like 23) The peptide sequence was selected from the middle region of CDH23. Peptide sequence DYISGVLTLNGLLDRENPLYSHGFILTVKGTELNDDRTPSDATVTTTFNI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CDH23
Conjugate Unconjugated
Supplier Page Shop

Product images