Cadherin-7 Antibody

Name Cadherin-7 Antibody
Supplier Novus Biologicals
Catalog NBP1-59270
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CDH7(cadherin 7, type 2) The peptide sequence was selected from the N terminal of CDH7. Peptide sequence PKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CDH7
Conjugate Unconjugated
Supplier Page Shop

Product images