Name | Cadherin-7 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59270 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CDH7(cadherin 7, type 2) The peptide sequence was selected from the N terminal of CDH7. Peptide sequence PKFLDGPYTAGVPEMSPVGTSVVQVTATDADDPTYGNSARVVYSILQGQP. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | CDH7 |
Conjugate | Unconjugated |
Supplier Page | Shop |