ICAM-5 Antibody
| Name | ICAM-5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59235 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to ICAM5(intercellular adhesion molecule 5, telencephalin) The peptide sequence was selected from the N terminal of ICAM5. Peptide sequence RRNGTQRGLRWLARQLVDIREPETQPVCFFRCARRTLQARGLIRTFQRPD. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | ICAM5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: ICAM-5 Antibody [NBP1-59235] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17235_ICAM-5-Antibody-Western-Blot-NBP1-59235-img0002.jpg)
Western Blot: ICAM-5 Antibody [NBP1-59235] - 293T cells lysate, concentration 0.2-1 ug/ml.