Kirrel2/NEPH3 Antibody

Name Kirrel2/NEPH3 Antibody
Supplier Novus Biologicals
Catalog NBP1-59231
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to KIRREL2(kin of IRRE like 2 (Drosophila)) The peptide sequence was selected from the N terminal of KIRREL2. Peptide sequence WSRYWISGNAANGQHDLHIRPVELEDEASYECQATQAGLRSRPAQLHVLV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene KIRREL2
Conjugate Unconjugated
Supplier Page Shop

Product images