EY Cadherin Antibody

Name EY Cadherin Antibody
Supplier Novus Biologicals
Catalog NBP1-59229
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CDH24(cadherin-like 24) The peptide sequence was selected from the N terminal of CDH24. Peptide sequence NPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTVLDG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CDH24
Conjugate Unconjugated
Supplier Page Shop

Product images