Integrin beta-like protein 1 Antibody

Name Integrin beta-like protein 1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59168
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ITGBL1(integrin, beta-like 1 (with EGF-like repeat domains)) The peptide sequence was selected from the N terminal of ITGBL1. Peptide sequence MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene ITGBL1
Conjugate Unconjugated
Supplier Page Shop

Product images