Name | Integrin beta-like protein 1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59168 |
Prices | $299.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to ITGBL1(integrin, beta-like 1 (with EGF-like repeat domains)) The peptide sequence was selected from the N terminal of ITGBL1. Peptide sequence MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | ITGBL1 |
Conjugate | Unconjugated |
Supplier Page | Shop |