HABP2 Antibody

Name HABP2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59163
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HABP2(hyaluronan binding protein 2) The peptide sequence was selected from the middle region of HABP2. Peptide sequence EPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HABP2
Conjugate Unconjugated
Supplier Page Shop

Product images