Name | HABP2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59163 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to HABP2(hyaluronan binding protein 2) The peptide sequence was selected from the middle region of HABP2. Peptide sequence EPSTKLPGFDSCGKTEIAERKIKRIYGGFKSTAGKHPWQASLQSSLPLTI. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | HABP2 |
Conjugate | Unconjugated |
Supplier Page | Shop |