MFAP4 Antibody
| Name | MFAP4 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59158 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to MFAP4(microfibrillar-associated protein 4) The peptide sequence was selected from the N terminal of MFAP4. Peptide sequence TEGGKWTVFQKRFNGSVSFFRGWNDYKLGFGRADGEYWLGLQNMHLLTLK. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | MFAP4 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: MFAP4 Antibody [NBP1-59158] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24822_MFAP4-Antibody-Western-Blot-NBP1-59158-img0003.jpg)
Western Blot: MFAP4 Antibody [NBP1-59158] - Titration: 0.2-1 ug/ml, Positive Control: MCF7 cell lysate.
![Immunohistochemistry: MFAP4 Antibody [NBP1-59158] - SampleType : Mouse sciatic nerve Dilution : 1: 500 Secondary Antibody : Biotinylated Anti-Rabbit 1: 1000 followed by avidin-biotin and diaminobenzidine Secondary Antibody Dilution : 1: 1000 Gene Name : MFAP4](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24823_MFAP4-Antibody-Immunohistochemistry-NBP1-59158-img0004.jpg)
Immunohistochemistry: MFAP4 Antibody [NBP1-59158] - SampleType : Mouse sciatic nerve Dilution : 1: 500 Secondary Antibody : Biotinylated Anti-Rabbit 1: 1000 followed by avidin-biotin and diaminobenzidine Secondary Antibody Dilution : 1: 1000 Gene Name : MFAP4