DGCR2 Antibody

Name DGCR2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59220
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Guinea Pig, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to DGCR2(DiGeorge syndrome critical region gene 2) The peptide sequence was selected from the middle region of DGCR2. Peptide sequence AESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEP.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene DGCR2
Supplier Page Shop

Product images