Name | DGCR2 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59220 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Rat, Pig, Bovine, Dog, Guinea Pig, Rabbit, Zebrafish |
Antigen | Synthetic peptides corresponding to DGCR2(DiGeorge syndrome critical region gene 2) The peptide sequence was selected from the middle region of DGCR2. Peptide sequence AESCYEKSSFLCKRSQTCVDIKDNVVDEGFYFTPKGDDPCLSCTCHGGEP. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | DGCR2 |
Supplier Page | Shop |