PCDHAC2 Antibody

Name PCDHAC2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59215
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PCDHAC2(protocadherin alpha subfamily C, 2) The peptide sequence was selected from the N terminal of PCDHAC2. Peptide sequence SPAFDQSTYRVQLREDSPPGTLVVKLNASDPDEGSNGELRYSLSSYTSDR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PCDHAC2
Conjugate Unconjugated
Supplier Page Shop

Product images