LAMP Antibody

Name LAMP Antibody
Supplier Novus Biologicals
Catalog NBP1-59212
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LSAMP(limbic system-associated membrane protein) The peptide sequence was selected from the N terminal of LSAMP. Peptide sequence MVRRVQPDRKQLPLVLLRLLCLLPTGLPVRSVDFNRGTDNITVRQGDTAI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LSAMP
Conjugate Unconjugated
Supplier Page Shop

Product images