DSCAM Antibody
| Name | DSCAM Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59208 |
| Prices | $329.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to DSCAM(Down syndrome cell adhesion molecule) The peptide sequence was selected from the middle region of DSCAM (NP_001380). Peptide sequence MRVCNSAGCAEKQANFATLNYDGSTIPPLIKSVVQNEEGLTTNEGLKMLV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | DSCAM |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: DSCAM Antibody [NBP1-59208] - Amount and Sample Type : 10 cm sq plate myc-DSCAM transfected mouse neuro2a cells Primary Antibody : DSCAM Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-Rabbit HRP Secondary Antibody Dilution : 1:5000 Gene Name : DSCAM](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/11_DSCAM%2520Antibody-Western%2520Blot-NBP1-59208-img0005.jpg)
Western Blot: DSCAM Antibody [NBP1-59208] - Amount and Sample Type : 10 cm sq plate myc-DSCAM transfected mouse neuro2a cells Primary Antibody : DSCAM Primary Antibody Dilution : 1:1000 Secondary Antibody : Anti-Rabbit HRP Secondary Antibody Dilution : 1:5000 Gene Name : DSCAM
![Western Blot: DSCAM Antibody [NBP1-59208] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/12_DSCAM-Antibody-Western-Blot-NBP1-59208-img0003.jpg)
Western Blot: DSCAM Antibody [NBP1-59208] - Titration: 0.2-1 ug/ml, Positive Control: HepG2 cell lysate.