Claudin-18 Antibody

Name Claudin-18 Antibody
Supplier Novus Biologicals
Catalog NBP1-59250
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CLDN18(claudin 18) The peptide sequence was selected from the middle region of CLDN18. Peptide sequence YHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEVQSYPSKHDY.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CLDN18
Conjugate Unconjugated
Supplier Page Shop

Product images