DHX15 Antibody

Name DHX15 Antibody
Supplier Novus Biologicals
Catalog NBP1-57204
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog, Horse, Rabbit, Zebrafish
Antigen Synthetic peptides corresponding to DHX15(DEAH (Asp-Glu-Ala-His) box polypeptide 15) The peptide sequence was selected from the C terminal of DHX15. Peptide sequence YINIRKALVTGYFMQVAHLERTGHYLTVKDNQVVQLHPSTVLDHKPEWVL.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene DHX15
Supplier Page Shop

Product images