hnRNP-R Antibody
| Name | hnRNP-R Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57158 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HNRNPR(heterogeneous nuclear ribonucleoprotein R) The peptide sequence was selected from the N terminal of HNRNPR. Peptide sequence ANQVNGNAVQLKEEEEPMDTSSVTHTEHYKTLIEAGLPQKVAERLDEIFQ. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HNRNPR |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: hnRNP-R Antibody [NBP1-57158] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6949_hnRNP-R-Antibody-Western-Blot-NBP1-57158-img0003.jpg)
Western Blot: hnRNP-R Antibody [NBP1-57158] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.
![Western Blot: hnRNP-R Antibody [NBP1-57158] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: 721_B cell lysate HNRNPR is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6950_hnRNP-R%2520Antibody-Western%2520Blot-NBP1-57158-img0004.jpg)
Western Blot: hnRNP-R Antibody [NBP1-57158] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1 : 62500 Positive control: 721_B cell lysate HNRNPR is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells.