Name | PRPF4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57150 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PRPF4(PRP4 pre-mRNA processing factor 4 homolog (yeast)) The peptide sequence was selected from the N terminal of PRPF4. Peptide sequence EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | PRPF4 |
Conjugate | Unconjugated |
Supplier Page | Shop |