PRPF4 Antibody

Name PRPF4 Antibody
Supplier Novus Biologicals
Catalog NBP1-57150
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PRPF4(PRP4 pre-mRNA processing factor 4 homolog (yeast)) The peptide sequence was selected from the N terminal of PRPF4. Peptide sequence EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPIT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PRPF4
Conjugate Unconjugated
Supplier Page Shop

Product images