RBMS3 Antibody

Name RBMS3 Antibody
Supplier Novus Biologicals
Catalog NBP1-57147
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RBMS3 (RNA binding motif, single stranded interacting protein) The peptide sequence was selected from the N terminal of RBMS3. Peptide sequence GVQAQMAKQQEQDPTNLYISNLPISMDEQELENMLKPFGHVISTRILRDA.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene RBMS3
Conjugate Unconjugated
Supplier Page Shop

Product images