RNPC3 Antibody

Name RNPC3 Antibody
Supplier Novus Biologicals
Catalog NBP1-57138
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Rat, Pig, Bovine, Dog
Antigen Synthetic peptides corresponding to RNPC3(RNA-binding region (RNP1, RRM) containing 3) The peptide sequence was selected from the middle region of RNPC3. Peptide sequence LHAPLPPTSPQPPEEPPLPDEDEELSSEESEYESTDDEDRQRMNKLMELA.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene RNPC3
Supplier Page Shop

Product images