SRP68 Antibody

Name SRP68 Antibody
Supplier Novus Biologicals
Catalog NBP1-57137
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SRP68(signal recognition particle 68kDa) The peptide sequence was selected from the N terminal of SRP68. Peptide sequence EENKENERPSAGSKANKEFGDSLSLEILQIIKESQQQHGLRHGDFQRYRG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SRP68
Conjugate Unconjugated
Supplier Page Shop

Product images