hnRNP AB Antibody

Name hnRNP AB Antibody
Supplier Novus Biologicals
Catalog NBP1-57172
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to HNRPAB The peptide sequence was selected from the N terminal of HNRPAB. Peptide sequence GAAAGAGGATAAPPSGNQNGAEGDQINASKNEEDAGKMFVGGLSWDTSKK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene HNRNPAB
Conjugate Unconjugated
Supplier Page Shop

Product images