ADAMTS18 Antibody

Name ADAMTS18 Antibody
Supplier Novus Biologicals
Catalog NBP1-57095
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ADAMTS18(ADAM metallopeptidase with thrombospondin type 1 motif, 18) The peptide sequence was selected from the N terminal of ADAMTS18. Peptide sequence FYQGFIRNDSSSSVAVSTCAGLSGLIRTRKNEFLISPLPQLLAQEHNYSS
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ADAMTS18
Conjugate Unconjugated
Supplier Page Shop

Product images