MOV10L1 Antibody

Name MOV10L1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57279
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MOV10L1(Mov10l1, Moloney leukemia virus 10-like 1, homolog (mouse)) The peptide sequence was selected from the N terminal of MOV10L1. Peptide sequence LNVGQEVIAVVEENKVSNGLKAIRVEAVSDKWEDDSRNHGSPSDCGPRVL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene MOV10L1
Conjugate Unconjugated
Supplier Page Shop

Product images