RBMS2 Antibody

Name RBMS2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57271
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RBMS2(RNA binding motif, single stranded interacting protein 2) The peptide sequence was selected from the N terminal of RBMS2. Peptide sequence MLLSVTSRPGISTFGYNRNNKKPYVSLAQQMAPPSPSNSTPNSSSGSNGN.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RBMS2
Conjugate Unconjugated
Supplier Page Shop

Product images