NXF5 Antibody
| Name | NXF5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57260 |
| Prices | $139.00, $299.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to NXF5 (nuclear RNA export factor 5) The peptide sequence was selected from the middle region of NXF5. Peptide sequence ITERNFPELLSLNLCNNKLYQLDGLSDITEKAPKVKTLNLSKNKLESAWE. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | NXF5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: NXF5 Antibody [NBP1-57260] - Lanes: Lane 1 : 7ug HeLa cystosolic extract Lane 2: 7ug HeLa nuclear extract Primary, Antibody Dilution: 1 : 100 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 500 Gene name: NXF5.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29811_NXF5%2520Antibody-Western%2520Blot-NBP1-57260-img0005.jpg)
Western Blot: NXF5 Antibody [NBP1-57260] - Lanes: Lane 1 : 7ug HeLa cystosolic extract Lane 2: 7ug HeLa nuclear extract Primary, Antibody Dilution: 1 : 100 Secondary Antibody: Anti-rabbit-HRP Secondary, Antibody Dilution: 1 : 500 Gene name: NXF5.
![Immunohistochemistry-Paraffin: NXF5 Antibody [NBP1-57260] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29812_NXF5-Antibody-Immunohistochemistry-Paraffin-NBP1-57260-img0004.jpg)
Immunohistochemistry-Paraffin: NXF5 Antibody [NBP1-57260] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
![Western Blot: NXF5 Antibody [NBP1-57260] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29813_NXF5-Antibody-Western-Blot-NBP1-57260-img0001.jpg)
Western Blot: NXF5 Antibody [NBP1-57260] - Jurkat cell lysate, Antibody Titration: 2.5ug/ml
![Immunohistochemistry-Paraffin: NXF5 Antibody [NBP1-57260] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/29814_NXF5-Antibody-Immunohistochemistry-Paraffin-NBP1-57260-img0002.jpg)
Immunohistochemistry-Paraffin: NXF5 Antibody [NBP1-57260] - Human Intestine Tissue, antibody concentration 4-8ug/ml. Cells with positive label: Epithelial cells of intestinal villus (indicated with arrows) 400X magnification.