CPEB2 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57259
• Prices: $139.00, $299.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CPEB2 (cytoplasmic polyadenylation element binding protein 2) The peptide sequence was selected from the middle region of CPEB2. Peptide sequence DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: CPEB2
• Conjugate: Unconjugated