JAKMIP1 Antibody

Name JAKMIP1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57249
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to JAKMIP1(janus kinase and microtubule interacting protein 1) The peptide sequence was selected from the middle region of JAKMIP1. Peptide sequence FLRLQVLEQQHVIDDLSLERERLLRSKRHRGKSLKPPKKHVVETFFGFDE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene JAKMIP1
Conjugate Unconjugated
Supplier Page Shop

Product images