RTCD1 Antibody

Name RTCD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57245
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RTCD1(RNA terminal phosphate cyclase domain 1) The peptide sequence was selected from the N terminal of RTCD1. Peptide sequence VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RTCA
Conjugate Unconjugated
Supplier Page Shop

Product images