SNRPA1 Antibody

Name SNRPA1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57240
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SNRPA1(small nuclear ribonucleoprotein polypeptide A') The peptide sequence was selected from the N terminal of SNRPA1 (NP_003081). Peptide sequence VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLGATLDQFDAIDFSD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SNRPA1
Conjugate Unconjugated
Supplier Page Shop

Product images