CARF/CDKN2AIP Antibody
| Name | CARF/CDKN2AIP Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-57236 |
| Prices | $299.00 |
| Sizes | 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB IHC IHC-P |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CARF The peptide sequence was selected from the C terminal of CARF. Peptide sequence AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | CDKN2AIP |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: CARF/CDKN2AIP Antibody [NBP1-57236] - Jurkat cell lysate, Antibody Titration: 0.3125ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24538_CARF-CDKN2AIP-Antibody-Western-Blot-NBP1-57236-img0001.jpg)
![Immunohistochemistry-Paraffin: CARF/CDKN2AIP Antibody [NBP1-57236] - Human Muscle Tissue, Skeletal muscle cells (Indicated with Arrows) 4-8ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_9/24539_CARF-CDKN2AIP-Antibody-Immunohistochemistry-Paraffin-NBP1-57236-img0003.jpg)