IMP3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57229
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB IHC
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to IMP3(IMP3, U3 small nucleolar ribonucleoprotein, homolog (yeast)) The peptide sequence was selected from the middle region of IMP3. Peptide sequence GHVRVGPDVVTDPAFLVTRSMEDFVTWVDSSKIKRHVLEYNEERDDFDLE.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: IMP3
• Conjugate: Unconjugated