RRP9 Antibody

Name RRP9 Antibody
Supplier Novus Biologicals
Catalog NBP1-57217
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RRP9 (RRP9, small subunit (SSU) processome component, homolog (yeast)) The peptide sequence was selected from the middle region of RRP9. Peptide sequence IPRAKKGAEGKPPGHSSHVLCMAISSDGKYLASGDRSKLILIWEAQSC
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene RRP9
Conjugate Unconjugated
Supplier Page Shop

Product images