DHX35 Antibody

Name DHX35 Antibody
Supplier Novus Biologicals
Catalog NBP1-57348
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DHX35(DEAH (Asp-Glu-Ala-His) box polypeptide 35) The peptide sequence was selected from the N terminal of DHX35. Peptide sequence MAAPVGPVKFWRPGTEGPGVSISEERQSLAENSGTTVVYNPYAALSIEQQ.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DHX35
Conjugate Unconjugated
Supplier Page Shop

Product images