DHX32 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-57347
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to DHX32(DEAH (Asp-Glu-Ala-His) box polypeptide 32) The peptide sequence was selected from the N terminal of DHX32. Peptide sequence EEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSSR.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: DHX32
• Conjugate: Unconjugated