DDX55 Antibody

Name DDX55 Antibody
Supplier Novus Biologicals
Catalog NBP1-57332
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DDX55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55) The peptide sequence was selected from the C terminal of DDX55. Peptide sequence GKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIK.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene DDX55
Conjugate Unconjugated
Supplier Page Shop

Product images