Name | DDX55 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57332 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to DDX55 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 55) The peptide sequence was selected from the C terminal of DDX55. Peptide sequence GKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIK. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | DDX55 |
Conjugate | Unconjugated |
Supplier Page | Shop |