PCBP3 Antibody

Name PCBP3 Antibody
Supplier Novus Biologicals
Catalog NBP1-57325
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PCBP3(poly(rC) binding protein 3) The peptide sequence was selected from the middle region of PCBP3. Peptide sequence QTPFPPLGQTNPAFPGEKLPLHSSEEAQNLMGQSSGLDASPPASTHELTI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PCBP3
Conjugate Unconjugated
Supplier Page Shop

Product images