STRBP Antibody

Name STRBP Antibody
Supplier Novus Biologicals
Catalog NBP1-57311
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to STRBP(spermatid perinuclear RNA binding protein) The peptide sequence was selected from the middle region of STRBP. Peptide sequence PSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene STRBP
Conjugate Unconjugated
Supplier Page Shop

Product images