RPL23AP82 Antibody

Name RPL23AP82 Antibody
Supplier Novus Biologicals
Catalog NBP1-57370
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to MGC70863(similar to RPL23AP7 protein) The peptide sequence was selected from the N terminal of MGC70863. Peptide sequence MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIE.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RPL23AP82
Conjugate Unconjugated
Supplier Page Shop

Product images