Synaptojanin 1 Antibody

Name Synaptojanin 1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57368
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SYNJ1(synaptojanin 1) The peptide sequence was selected from the middle region of SYNJ1. Peptide sequence PGVARREMEAPKSPGTTRKDNIGRSQPSPQAGLAGPGPAGYSTARPTIPP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SYNJ1
Conjugate Unconjugated
Supplier Page Shop

Product images