DHX34 Antibody

Name DHX34 Antibody
Supplier Novus Biologicals
Catalog NBP1-57294
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human, Mouse, Bovine, Dog, Horse, Guinea Pig, Rabbit
Antigen Synthetic peptides corresponding to DHX34(DEAH (Asp-Glu-Ala-His) box polypeptide 34) The peptide sequence was selected from the middle region of DHX34. Peptide sequence VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene DHX34
Supplier Page Shop

Product images