Name | DHX34 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-57294 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human, Mouse, Bovine, Dog, Horse, Guinea Pig, Rabbit |
Antigen | Synthetic peptides corresponding to DHX34(DEAH (Asp-Glu-Ala-His) box polypeptide 34) The peptide sequence was selected from the middle region of DHX34. Peptide sequence VPGRLFPITVVYQPQEAEPTTSKSEKLDPRPFLRVLESIDHKYPPEERGD. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | DHX34 |
Supplier Page | Shop |